IL1 Receptor antibody

• Catalog Number: orb333740
• Category: Antibodies
• Description: Rabbit polyclonal antibody to IL1 Receptor
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Animal, Canine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63kDa
• Target: IL1R1
• UniProt ID: P14778
• Protein Sequence: Synthetic peptide located within the following region: LELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYH
• NCBI: NP_000868
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P80, IL1R, IL1RA, CD121A, D2S1473, IL-1R-alpha
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Fetal Heart tissue using IL1 Receptor antibody

Western blot analysis of human NT2 cell line tissue using IL1 Receptor antibody