You have no items in your shopping cart.
Page Not Found
Cart summary
IL-13 Protein, Equus caballus, Recombinant (His)
Catalog Number: orb1979362
| Catalog Number | orb1979362 |
|---|---|
| Category | Proteins |
| Description | IL-13 Protein, Equus caballus, Recombinant (His) is expressed in Yeast. |
| Tag | C-6xHis |
| Purity | 98.00% |
| Protein Sequence | APLPSSMALKELIKELVNITQNQAPLCNGSMVWSVNLTADTYCRALESLSNVSTCSAIQNTRKMLTKLCPHQLSAGQVSSERARDTKIEVIVLVKDLLKNLRKIFHGGKHVDA |
| UniProt ID | B6C802 |
| MW | 13.9 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Horse |
| Biological Activity | IL-13 Protein, Equus caballus, Recombinant (His) is expressed in Yeast. |
| Expression Region | 21-133 aa |
| Storage | -20°C |
| Note | For research use only |
