You have no items in your shopping cart.
Cart summary
IL-11 Protein, Rat, Recombinant (His & PDI)
Catalog Number: orb1976602
| Catalog Number | orb1976602 |
|---|---|
| Category | Proteins |
| Description | IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5. |
| Tag | N-6xHis-PDI |
| Purity | 98.00% |
| MW | 78.0 kDa (predicted) |
| UniProt ID | Q99MF5 |
| Protein Sequence | PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Rat |
| Biological Activity | IL-11 Protein, Rat, Recombinant (His & PDI) is expressed in yeast with N-6xHis-PDI tag. The predicted molecular weight is 78.0 kDa and the accession number is Q99MF5. |
| Expression Region | 22-199 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
