You have no items in your shopping cart.
Cart summary
IGFLR1 Protein, Human, Recombinant (His)
Catalog Number: orb1978400
| Catalog Number | orb1978400 |
|---|---|
| Category | Proteins |
| Description | Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2. |
| Tag | C-6xHis |
| Purity | 98.00% |
| Protein Sequence | SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP |
| UniProt ID | Q9H665 |
| MW | 17.4 kDa (predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | HEK293 Cells |
| Biological Origin | Human |
| Biological Activity | Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2. |
| Expression Region | 23-163 aa |
| Storage | -20°C |
| Note | For research use only |
