IFN gamma Protein, Sheep, Recombinant (His)

• Catalog Number: orb1976426
• Category: Proteins
• Description: IFN gamma Protein, Sheep, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.9 kDa and the accession number is P17773.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 18.9 kDa (predicted)
• UniProt ID: P17773
• Protein Sequence: QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
• Expression System: P. pastoris (Yeast)
• Biological Origin: Sheep
• Biological Activity: IFN gamma Protein, Sheep, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.9 kDa and the accession number is P17773.
• Expression Region: 24-166a
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.