You have no items in your shopping cart.
Cart summary
IFN gamma Protein, Marmota monax, Recombinant (His)
Catalog Number: orb1977469
| Catalog Number | orb1977469 |
|---|---|
| Category | Proteins |
| Description | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. IFN gamma Protein, Marmota monax, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is O35735. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 18.6 kDa (predicted) |
| UniProt ID | O35735 |
| Protein Sequence | QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDKWKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSMDTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKIQRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRRASK |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Marmota monax |
| Biological Activity | Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. IFN gamma Protein, Marmota monax, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 18.6 kDa and the accession number is O35735. |
| Expression Region | 24-166 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
