You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291575 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant IFITM3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 4C8-1B10 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | IFITM3 (AAH06794, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG |
NCBI | AAH06794 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged IFITM3 is approximately 0.3 ng/ml as a capture antibody.
IFITM3 monoclonal antibody (M01), clone 4C8-1B10 Western Blot analysis of IFITM3 expression in Hela.
Western Blot detection against Immunogen (40.37 KDa).