IFI35 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2292745
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human IFI35 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human, Mouse
• Immunogen: IFI35 (NP_005524.1, 1 a.a. ~ 288 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
• NCBI: NP_005524.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

IFI35 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFI35 expression in A-431.

IFI35 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFI35 expression in Raw 264.7.

Immunofluorescence of purified MaxPab antibody to IFI35 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of IFI35 expression in transfected 293T cell line by IFI35 MaxPab polyclonal antibody. Lane 1: IFI35 transfected lysate (31.70 KDa). Lane 2: Non-transfected lysate.