IFI35 monoclonal antibody (M01), clone 3H6

• Catalog Number: orb2292744
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant IFI35.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: IFI35 (NP_005524, 189 a.a. ~ 288 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: GVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
• Tested applications: ELISA, WB
• Clone Number: 3H6
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005524
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged IFI35 is approximately 0.1 ng/ml as a capture antibody.

IFI35 monoclonal antibody (M01), clone 3H6 Western Blot analysis of IFI35 expression in A-431.

Western Blot detection against Immunogen (36.74 KDa).