IDH1 Antibody (monoclonal, 16H7)

• Catalog Number: orb623769
• Category: Antibodies
• Description: IDH1 Antibody (monoclonal, 16H7)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 16H7
• Tested applications: FC, ICC, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• MW: 46659 MW
• UniProt ID: O75874
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Cytosolic NADP isocitrate dehydrogenase antibody|C
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of CACO-2 cells using anti-IDH1 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.

IF analysis of IDH1 using anti-IDH1 antibody.

WB analysis using anti-IDH1 antibody.Lane 1:rat liver tissue, Lane 2:rat RH35 cell, Lane 3:mouse liver cell