You have no items in your shopping cart.
Cart summary
Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar)
Catalog Number: orb1976277
| Catalog Number | orb1976277 |
|---|---|
| Category | Proteins |
| Description | Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073. |
| Tag | N-6xHis-SUMOstar |
| Purity | 98.00% |
| MW | 23.2 kDa (predicted) |
| UniProt ID | P79073 |
| Protein Sequence | AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Hypocrea jecorina |
| Biological Activity | Responsible for spore hydrophobicity and protection. Hydrophobin-2/HFB2 Protein, Trichoderma reesei, Recombinant (His & SUMOstar) is expressed in yeast with N-6xHis-SUMOSTAR tag. The predicted molecular weight is 23.2 kDa and the accession number is P79073. |
| Expression Region | 16-86 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
