You have no items in your shopping cart.
Cart summary
Human TLR10 protein
Catalog Number: orb419261
| Catalog Number | orb419261 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Toll-like receptor 10 |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 84.6 kDa |
| UniProt ID | Q9BXR5 |
| Protein Sequence | DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWPETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNT |
| Protein Length | Partial |
| Source | in vitro E.coli expression system |
| Expression System | Expression Region: 20-576aa. Protein Length: Partial |
| Expression Region | 20-576aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD_antigen, CD290 Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 20-576aaSequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
Human TLR10 protein [orb54729]
Greater than 90% as determined by SDS-PAGE.
68.1 kDa
in vitro E.coli expression system
20 μg, 100 μgRecombinant Human CD290/TLR10 Protein, His Tag [orb1553185]
≥90% as determined by SDS-PAGE
This protein contains the human TLR10(Met1-Thr576) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgTLR10 Recombinant Protein (Human) [orb2050374]
Greater than 90% as determined by SDS-PAGE.
68.1 kDa
E.coli
20 μgTLR10 Recombinant Protein (Human) [orb2050375]
Greater than 90% as determined by SDS-PAGE.
68.1 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars