You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb80164 |
---|---|
Category | Proteins |
Description | Human TARC protein |
Tested applications | FA, HPLC, SDS-PAGE |
Purity | > 97.0% as determined by RP-HPLC and analysis by SDS-PAGE |
Conjugation | Unconjugated |
Target | Human TARC |
Solubility (25°C) | It is recommended to reconstitute the lyophilized CCL17 in sterile H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
Protein Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS. |
Biological Activity | Determined by its ability to chemoattract human T-Lymphocytes using concentration range of 1.0-10.0 ng/ml. |
Storage | Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles. |
Buffer/Preservatives | The protein was lyophilized from concentrated (0.5mg/ml) solution containing 20 mM PBS 150mM NaCl pH-7.4. |
Alternative names | Thymus and activation-regulated chemokine protein, Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
> 97% as determined by SDS-PAGE and HPLC. | |
8.1 kDa | |
E.Coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
9.1 KDa | |
Mammalian |
Filter by Rating