You have no items in your shopping cart.
Cart summary
Human TARC protein
Catalog Number: orb80164
| Catalog Number | orb80164 |
|---|---|
| Category | Proteins |
| Description | Human TARC protein |
| Tested applications | FA, HPLC, SDS-PAGE |
| Purity | > 97.0% as determined by RP-HPLC and analysis by SDS-PAGE |
| Conjugation | Unconjugated |
| Target | Human TARC |
| Solubility (25°C) | It is recommended to reconstitute the lyophilized CCL17 in sterile H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions. |
| Protein Sequence | ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS. |
| Biological Origin | E.coli |
| Biological Activity | Determined by its ability to chemoattract human T-Lymphocytes using concentration range of 1.0-10.0 ng/ml. |
| Storage | Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles. |
| Buffer/Preservatives | The protein was lyophilized from concentrated (0.5mg/ml) solution containing 20 mM PBS 150mM NaCl pH-7.4. |
| Alternative names | Thymus and activation-regulated chemokine protein, Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CCL17 protein (Active) [orb359045]
> 97% as determined by SDS-PAGE and HPLC.
8.1 kDa
E.Coli
5 μg, 100 μg, 500 μg - Item 1 of 1
Human CCL17 (C-6His) Protein [orb1471745]
Greater than 95% as determined by reducing SDS-PAGE.
9.1 KDa
Mammalian
50 μg, 10 μg - Item 1 of 1
Human CCL17 Protein, hFc Tag [orb2321411]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.2 kDa after removal of the signal peptide. The apparent molecular mass of CCL17-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg Human CCL17 protein [orb706818]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgCCR4 Protein, Human, Recombinant (His & SUMO) [orb1978850]
98.00%
19.0 kDa (predicted)
1 mg, 100 μg, 20 μg
