Human TARC protein

• Catalog Number: orb80164
• Category: Proteins
• Description: Human TARC protein
• Tested applications: FA, HPLC, SDS-PAGE
• Purity: > 97.0% as determined by RP-HPLC and analysis by SDS-PAGE
• Conjugation: Unconjugated
• Target: Human TARC
• Solubility (25°C): It is recommended to reconstitute the lyophilized CCL17 in sterile H₂O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
• Protein Sequence: ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.
• Biological Activity: Determined by its ability to chemoattract human T-Lymphocytes using concentration range of 1.0-10.0 ng/ml.
• Storage: Store at 4°C for up to two weeks. For long term storage, aliquot and store at -20°C, avoid freeze/thaw cycles.
• Buffer/Preservatives: The protein was lyophilized from concentrated (0.5mg/ml) solution containing 20 mM PBS 150mM NaCl pH-7.4.
• Alternative names: Thymus and activation-regulated chemokine protein,
• Note: For research use only
• Expiration Date: 6 months from date of receipt.