You have no items in your shopping cart.
Cart summary
Human rhinovirus 1A (HRV-1A) Genome polyprotein (His)
Catalog Number: orb1977881
| Catalog Number | orb1977881 |
|---|---|
| Category | Proteins |
| Description | Human rhinovirus 1A (HRV-1A) Genome polyprotein (His) is expressed in Yeast. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 34.6 kDa (predicted) |
| UniProt ID | P23008 |
| Protein Sequence | NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | HRV-1A |
| Biological Activity | Human rhinovirus 1A (HRV-1A) Genome polyprotein (His) is expressed in Yeast. |
| Expression Region | 571-857 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
