Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human PRKRIR protein
Catalog Number orb244460
Species/HostHuman
ConjugationUnconjugated
Target PRKRIR
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Purity >90% as determined by SDS-PAGE.
MW 33.6 kDa
Source E. coli
Uniprot ID O43422
Product Description

Recombinant human 52 kDa repressor of the inhibitor of the protein kinase

Application Notes
Application Notes Partial of Isoform Long of His-SUMO-tag and expression region is 612-761aa
Reviews
Write Your Own Review
You're reviewing:Human PRKRIR protein - orb244460
Your Rating