You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human LY6G6D protein
Catalog Number: orb604235
| Catalog Number | orb604235 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D) |
| Tag | N-terminal 10xHis-B2M-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | O95868 |
| MW | 25.5 kDa |
| Application notes | Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 20-104aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Megakaryocyte-enhanced gene transcript 1 protein C Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial [orb1785279]
Greater than 90% as determined by SDS-PAGE.
38.0 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 2
Human LY6G6D protein [orb245910]
Greater than 95% as determined by SDS-PAGE.
11.1 kDa
Yeast
100 μg, 20 μg, 1 mg - Item 1 of 1
Human LY6G6D protein [orb419195]
Greater than 85% as determined by SDS-PAGE.
15.5 kDa
E.coli
100 μg, 1 mg, 20 μg - Item 1 of 1
Human LY6G6D Protein [orb1478145]
Greater than 90% as determined by SDS-PAGE.
12.0 kDa
Yeast
1 mg, 100 μg, 20 μg 
