You have no items in your shopping cart.
Cart summary
Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His)
Catalog Number: orb1978465
| Catalog Number | orb1978465 |
|---|---|
| Category | Proteins |
| Description | Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) is expressed in Yeast. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 46.8 kDa (predicted) |
| UniProt ID | P52439 |
| Protein Sequence | MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | HHV-6A |
| Biological Activity | Human herpesvirus 6A (HHV-6 variant A) (strain Uganda-1102) DNA polymerase processivity factor (His) is expressed in Yeast. |
| Expression Region | 1-393 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
