You have no items in your shopping cart.
Featured
Description
Research Area
Metabolism Research
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 32-193aa |
| Protein Length | Full Length of Mature Protein |
| MW | 44.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Cerebroside sulfate activator protein, GM2-APSphingolipid activator protein 3 , SAP-3
Similar Products
−- Item 1 of 1
Human GM2 Ganglioside Activator (GM2A) ELISA Kit [orb779991]
Human
0.16-10 ng/mL
0.066 ng/mL
48 T, 96 T - Item 1 of 4
GM2A Antibody [orb400132]
ELISA, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg 
Recombinant Human GM2A Protein [orb2994518]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 18.6 KDa. Observed: 19-22 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 2
- Item 1 of 1
Human GM2A(GM2 Ganglioside Activator) Microsample ELISA Kit [orb2997971]
Human
0.16-10 ng/mL
0.065 ng/mL
48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks