You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb383438 |
---|---|
Category | Proteins |
Description | Recombinant human CXCL10 protein |
Tag | N-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Protein Length | Full Length of Mature Protein |
UniProt ID | P02778 |
MW | 12.6 kDa |
Application notes | Baculovirus and Mammalian Cell N-terminal 6xHis-tagged Full Length |
Endotoxins | Not test. |
Source | Mammalian cell |
Biological Origin | Homo sapiens (Human) |
Expression Region | 22-98aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | 10KDA interferon gamma-induced protein Short name, Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 97 % by SDS-PAGE and HPLC analyses. | |
Approximately 8.6 kDa, a single non-glycosylated polypeptide chain containing 77 amino acids. | |
Escherichia coli |
IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Recombinant | |
Unconjugated |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 34.8 kDa after removal of the signal peptide.The apparent molecular mass of cCXCL10-hFc is approximately 25-55 kDa due to glycosylation. | |
Mammalian |
The purity of the protein is greater than 90% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 34.8 kDa after removal of the signal peptide. | |
Mammalian |