You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244080 |
---|---|
Category | Proteins |
Description | Recombinant human C-C motif chemokine 8 |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 35.9 kDa |
UniProt ID | P80075 |
Protein Sequence | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 24-99aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CCL8 Read more... |
Note | For research use only |
Application notes | Full length of GST-tag and expression region is 24-99aa |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 96% as determined by SDS-PAGE and HPLC. | |
8.9 kDa | |
E.Coli |
> 96 % by SDS-PAGE and HPLC analyses. | |
Approximately 8.9 kDa, a single non-glycosylated polypeptide chain containing 76 amino acids. | |
Escherichia coli |
Greater than 95% as determined by reducing SDS-PAGE. | |
9.95 KDa | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
10.9 kDa | |
Yeast |