You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb402260 |
---|---|
Category | Antibodies |
Description | HTRA1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human HTRA1 (QLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIAD). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 51 kDa |
UniProt ID | Q92743 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Serine protease HTRA1; High-temperature requiremen Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of HTRA1 using anti-HTRA1 antibody.Lane 1:human MCF-7 cell;2:rat heart tissue;3:mouse heart tissue.
IHC analysis of HTRA1 using anti-HTRA1 antibody.HTRA1 was detected in paraffin-embedded section of human rectal cancer tissue.
ELISA, FA, FACS, Kinetics | |
Human | |
Monoclonal | |
Unconjugated |
Filter by Rating