HSF2BP Antibody

• Catalog Number: orb2236444
• Category: Antibodies
• Description: HSF2BP Antibody
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1C4
• Tested applications: ELISA, WB
• Isotype: IgG2a Kappa
• Immunogen: HSF2BP (NP_008962.1, 231 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Form/Appearance: Liquid
• Conjugation: Unconjugated
• Protein Sequence: VLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
• NCBI: NP_008962.1
• Storage: Store at -2°C or lower. Aliquot to avoid repeated freezing and thawing.
• Buffer/Preservatives: Liquid
• Alternative names: heat shock factor 2-binding protein;MEILB2;meiotic
• Note: For research use only
• Expiration Date: 12 months from date of receipt.