You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2053753 |
---|---|
Category | Proteins |
Description | HSD17B11 Recombinant Protein (Human) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 46.8 kDa |
UniProt ID | Q8NBQ5 |
Protein Sequence | ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ |
Source | E.coli |
NCBI | NP_057329 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 17-BETA-HSD11;17-BETA-HSDXI;17-beta-hydroxysteroid Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
46.8 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
46.8 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
46.8 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
29.2 kDa | |
E.Coli |
Filter by Rating