You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2052596 |
---|---|
Category | Proteins |
Description | HRH1 Recombinant Protein (Human) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 27.1 kDa |
UniProt ID | P35367 |
Protein Sequence | AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ |
Source | E.coli |
NCBI | NP_000852 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | H1R;H1-R;HH1R;hisH1;histamine H1 receptor;histamin Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
27.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
27.1 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
27.1 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% by SDS-PAGE gel analyses | |
43.8 kDa | |
E.Coli |
Filter by Rating