You have no items in your shopping cart.
Cart summary
HP-0175 Protein, Helicobacter pylori, Recombinant (GST)
Catalog Number: orb1979115
| Catalog Number | orb1979115 |
|---|---|
| Category | Proteins |
| Description | HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112. |
| Tag | N-GST |
| Purity | 98.00% |
| MW | 58.8 kDa (predicted) |
| UniProt ID | P56112 |
| Protein Sequence | KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK |
| Expression System | E. coli |
| Biological Origin | Helicobacter pylori |
| Biological Activity | N/A. HP-0175 Protein, Helicobacter pylori, Recombinant (GST) is expressed in E. coli expression system with N-GST tag. The predicted molecular weight is 58.8 kDa and the accession number is P56112. |
| Expression Region | 22-299 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
