You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
HOXC10 polyclonal antibody (A02)
Catalog Number: orb2292780
| Catalog Number | orb2292780 |
|---|---|
| Category | Antibodies |
| Description | Mouse polyclonal antibody raised against a partial recombinant HOXC10. |
| Clonality | Polyclonal |
| Species/Host | Mouse |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Buffer/Preservatives | 50 % glycerol |
| Immunogen | HOXC10 (AAH01293, 158 a.a. ~ 257 a.a) partial recombinant protein with GST tag. |
| Protein Sequence | LDKTPHCSGANDFEAPFEQRASLNPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADSSPDTSDNEAKEEIKAEN |
| Tested applications | ELISA, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | AAH01293 |
HOXC10 polyclonal antibody (A02), Western Blot analysis of HOXC10 expression in Hela S3 NE.
Western Blot detection against Immunogen (37 KDa).
