HOXA7 monoclonal antibody (M01), clone 2F2

• Catalog Number: orb2292790
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HOXA7.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F2
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: HOXA7 (NP_008827, 58 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: NSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGACDKTDEGALHGA
• NCBI: NP_008827
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged HOXA7 is approximately 0.1 ng/ml as a capture antibody.

Western Blot analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2. Lane 1: HOXA7 transfected lysate (25.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (31.79 KDa).