You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2050674 |
---|---|
Category | Proteins |
Description | HNRNPA2B1 Recombinant Protein (Mouse) |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 53.4 kDa |
UniProt ID | O88569 |
Protein Sequence | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
Source | E.coli |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | 9130414A06Rik;heterogeneous nuclear ribonucleoprot Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
43.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
57.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
53.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
53.4 kDa | |
E.coli |
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
38.7 kDa | |
E.Coli |
Filter by Rating