HnRNP H/HNRNPH1 Antibody

• Catalog Number: orb389415
• Category: Antibodies
• Description: HnRNP H/HNRNPH1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 49229 MW
• UniProt ID: P31943
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Heterogeneous nuclear ribonucleoprotein H;hnRNP H;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of 293T cells using anti-HnRNP H/HNRNPH1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of Neuro2a cells using anti-HnRNP H/HNRNPH1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

Flow Cytometry analysis of C6 cells using anti-HnRNP H/HNRNPH1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG. Unlabelled sample (Red line) was also used as a control.

WB analysis using anti-HnRNP H/HNRNPH1 antibody.Lane 1:human 293T cell;2:human HeLa cell;3:human HepG2 cell;4:human MCF-7 cell;5:human LNCAP cell;6:human U2OS cell;7:human RT4 cell;8:rat C6 cell;9:rat PC-12 cell;10:mouse NIH/3T3 cell.

IF analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in an immunocytochemical section of MCF-7 cells.

IF analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human breast cancer tissue.

IF analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of rat brain tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human breast cancer tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human glioblastoma tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human ovarian serous adenocarcinoma tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human colorectal adenocarcinoma tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of human tonsil tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of mouse brain tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of rat brain tissue.

IHC analysis of HnRNP H/HNRNPH1 using anti-HnRNP H/HNRNPH1 antibody. HnRNP H/HNRNPH1 was detected in a paraffin-embedded section of rat brain hippocampus tissue.