You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb412956 |
---|---|
Category | Antibodies |
Description | hnRNP A2B1/HNRNPA2B1 Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | FC, ICC, IF, IHC, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence of human hnRNP A2B1 (KTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKL). |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot,0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 37 kDa |
UniProt ID | P22626 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Heterogeneous nuclear ribonucleoproteins A2/B1; hn Read more... |
Note | For research use only |
Application notes | Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of A431 cells using anti-hnRNP A2B1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.
WB analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human MDA-MB-453 cell;4:human SW620 cell;5:human HepG2 cell;6:human 22RV1 cell;7:human A431 cell;8:human A375 cell.
IF analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in immunocytochemical section of U20S cells.
IHC analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in paraffin-embedded section of human intestinal cancer tissue.
IHC analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in paraffin-embedded section of rat brain tissue.
IHC analysis of hnRNP A2B1 using anti-hnRNP A2B1 antibody. hnRNP A2B1 was detected in paraffin-embedded section of mouse brain tissue.
Filter by Rating