You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292804 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant HMGCS2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2a Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | HMGCS2 (NP_005509.1, 424 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV |
Tested applications | ELISA, WB |
Clone Number | 1E9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_005509.1 |
Detection limit for recombinant GST tagged HMGCS2 is approximately 1 ng/ml as a capture antibody.
Western Blot analysis of HMGCS2 expression in transfected 293T cell line by HMGCS2 monoclonal antibody (M06), clone 1E9. Lane 1: HMGCS2 transfected lysate (56.6 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (35.09 KDa).