HMGCS2 monoclonal antibody (M06), clone 1E9

• Catalog Number: orb2292804
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HMGCS2.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: HMGCS2 (NP_005509.1, 424 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
• Tested applications: ELISA, WB
• Clone Number: 1E9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_005509.1

Detection limit for recombinant GST tagged HMGCS2 is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of HMGCS2 expression in transfected 293T cell line by HMGCS2 monoclonal antibody (M06), clone 1E9. Lane 1: HMGCS2 transfected lysate (56.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.09 KDa).