HMGB2 monoclonal antibody (M03), clone 3C7

• Catalog Number: orb2292807
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant HMGB2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C7
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: HMGB2 (AAH00903.2, 1 a.a. ~ 195 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEE
• NCBI: AAH00903.2
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged HMGB2 is approximately 0.3 ng/ml as a capture antibody.

HMGB2 monoclonal antibody (M03), clone 3C7 Western Blot analysis of HMGB2 expression in Hela S3 NE.

Immunoperoxidase of monoclonal antibody to HMGB2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1.5 ug/ml]

Western Blot analysis of HMGB2 expression in transfected 293T cell line by HMGB2 monoclonal antibody (M03), clone 3C7. Lane 1: HMGB2 transfected lysate (22 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (47.19 KDa).