HMGB1 Antibody

• Catalog Number: orb389479
• Category: Antibodies
• Description: HMGB1 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IF, IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human HMGB1 (124-154aa DVAKKLGEMWNNTAADDKQPYEKKAAKLKEK), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat Western blot, 0.1-0.5μg/ml, Human, Mouse, RatImmunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 24894 MW
• UniProt ID: P09429
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: High mobility group protein B1;High mobility group
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of THP-1 cells using anti-HMGB1 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of HMGB1 using anti-HMGB1 antibody.Lane 1:human HeLa cell;2:human 293T cell;3:human K562 cell;4:human Jurkat cell;5:rat brain tissue;6:mouse brain tissue.

IF analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in immunocytochemical section of U20S cells.

IF analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in immunocytochemical section of A431 cells.

IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of mouse intestine tissues.

IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of mouse liver tissues.

IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of rat intestine tissues.

IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of rat liver tissues.

IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of human mammary cancer tissues.

IHC analysis of HMGB1 using anti-HMGB1 antibody. HMGB1 was detected in paraffin-embedded section of human placenta tissues.