You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb623775 |
---|---|
Category | Antibodies |
Description | HMG4 Antibody (monoclonal, 8H9) |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 8H9 |
Tested applications | FC, ICC, IF, WB |
Reactivity | Human, Mouse, Rat |
Isotype | Mouse IgG2b |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR), identical to the related mouse and rat sequences. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat Immunocytochemistry/Immunofluorescence, 2μg/ml, Human Flow Cytometry, 1-3μg/1x106 cells, Human |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 23 kDa |
UniProt ID | O15347 |
Sensitivity | > 5000 cells |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | "chromosomal protein, Nonhistone, HMG4 antibody|Hi Read more... |
Note | For research use only |
Application notes | Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500μg/ml. |
Expiration Date | 12 months from date of receipt. |
Flow Cytometry analysis of HeLa cells using anti-HMGB3 antibody(Blue line).Isotype control antibody (Green line) was mouse IgG.Unlabelled sample (Red line) was also used as a control.
IF analysis of HMGB3 using anti-HMGB3 antibody.
WB analysis using anti-HMGB3 antibody.Lane 1:rat brain tissue, Lane 2:rat liver cell, Lane 3:mouse Ana-1 cell.
WB analysis using anti-HMGB3 antibody.Lane 1:placenta tissue, Lane 2:HeLa cell, Lane 3:T-47D cell, Lane 4:HepG2 cell, Lane 5:Caco-2 cell.Lane 6:SW620 cell, Lane 7:Raji cell.
Filter by Rating