You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1976366 |
---|---|
Category | Proteins |
Description | Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. HlgB Protein, S. aureus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P0A075. |
Tag | N-6xHis |
Purity | 98.00% |
MW | 36.1 kDa (predicted) |
UniProt ID | P0A075 |
Protein Sequence | AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK |
Expression System | P. pastoris (Yeast) |
Biological Origin | Staphylococcus aureus |
Biological Activity | Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity. HlgB Protein, S. aureus, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 36.1 kDa and the accession number is P0A075. |
Expression Region | 26-325 aa |
Storage | -20°C |
Note | For research use only |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expiration Date | 6 months from date of receipt. |
98.00% | |
38.1 kDa (predicted) |