HLF monoclonal antibody (M04), clone M2

• Catalog Number: orb2292813
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant HLF.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: M2
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: HLF (AAH36093, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
• NCBI: AAH36093
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunofluorescence of monoclonal antibody to HLF on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of HLF expression in transfected 293T cell line by HLF monoclonal antibody (M04), clone M2. Lane 1: HLF transfected lysate (33.2 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of HLF over-expressed 293 cell line, cotransfected with HLF Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HLF monoclonal antibody (M04), clone M2 (Cat # orb2292813). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (58.19 KDa).