Histone H2B Antibody (Acetyl-Lys12)

• Catalog Number: orb2240352
• Category: Antibodies
• Description: Histone H2B Antibody (Acetyl-Lys12)
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, ICC, IF, IHC, IHC-P, WB
• Isotype: IgG
• Immunogen: The antiserum was produced against synthesized peptide derived from human Histone H2B around the acetylated site of Lys12.
• Form/Appearance: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Conjugation: Unconjugated
• MW: 13 kDa
• UniProt ID: P57053
• Protein Sequence: Synthetic peptide located within the following region: APKKGSKKAVTKAQKKDGRKRKRSRKESYSVYVYKVLKQVHPDTGISSKA
• Storage: -20°C
• Buffer/Preservatives: Liquid. PBS (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
• Alternative names: H2B histone family member S;H2B/s;H2BFS;histone H2
• Note: For research use only
• Application notes: Application Info: WB 1:500~1000IHC 1:50~100IF 1:100~500ELISA 1:1000
• Expiration Date: 12 months from date of receipt.