You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291901 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant HIST1H3D. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG3 Kappa |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | HIST1H3D (NP_003521, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE |
Tested applications | ELISA, IF, IHC-P, WB |
Clone Number | 1D8 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_003521 |
Detection limit for recombinant GST tagged HIST1H3D is 0.3 ng/ml as a capture antibody.
HIST1H3D monoclonal antibody (M01), clone 1D8 Western Blot analysis of HIST1H3D expression in Hela S3 NE.
HIST1H3D monoclonal antibody (M01), clone 1D8. Western Blot analysis of HIST1H3D expression in NIH/3T3.
HIST1H3D monoclonal antibody (M01), clone 1D8. Western Blot analysis of HIST1H3D expression in Raw 264.7.
Immunofluorescence of monoclonal antibody to HIST1H3D on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to HIST1H3D on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (32.34 KDa).