You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb234299 |
---|---|
Category | Antibodies |
Description | HIF-1-alpha/HIF1A Antibody |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Hamster |
Reactivity | Human, Mouse, Rat |
Isotype | Rabbit IgG |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids. |
Concentration | Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml. |
Dilution range | Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By HeatWestern blot, 0.1-0.5μg/ml, Human, Mouse |
Form/Appearance | Lyophilized |
Conjugation | Unconjugated |
MW | 92670 MW |
UniProt ID | Q16665 |
Storage | Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles. |
Alternative names | Hypoxia-inducible factor 1-alpha;HIF-1-alpha;HIF1- Read more... |
Note | For research use only |
Application notes | WB: The detection limit for HIF-1-alpha is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml. |
Expiration Date | 12 months from date of receipt. |
WB analysis of HIF-1-alpha/HIF1A using anti-HIF-1-alpha/HIF1A antibody.Lane 1:human PC-3 cell;2:human Caco-2 cell.
IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody.HIF 1 alpha was detected in paraffin-embedded section of mouse intestine tissue.
IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody.HIF 1 alpha was detected in paraffin-embedded section of rat intestine tissue.
IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody.HIF 1 alpha was detected in paraffin-embedded section of human intestinal cancer tissue.
ELISA, FC, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating