HIF-1-alpha/HIF1A Antibody

• Catalog Number: orb234299
• Category: Antibodies
• Description: HIF-1-alpha/HIF1A Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminal of human HIF-1-alpha (703-732aa EEELNPKILALQNAQRKRKMEHDGSLFQAV), different from the related mouse and rat sequences by three amino acids.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By HeatWestern blot, 0.1-0.5μg/ml, Human, Mouse
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 92670 MW
• UniProt ID: Q16665
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Hypoxia-inducible factor 1-alpha;HIF-1-alpha;HIF1-
• Note: For research use only
• Application notes: WB: The detection limit for HIF-1-alpha is approximately 0.25ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of HIF-1-alpha/HIF1A using anti-HIF-1-alpha/HIF1A antibody.Lane 1:human PC-3 cell;2:human Caco-2 cell.

IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody.HIF 1 alpha was detected in paraffin-embedded section of mouse intestine tissue.

IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody.HIF 1 alpha was detected in paraffin-embedded section of rat intestine tissue.

IHC analysis of HIF 1 alpha using anti-HIF 1 alpha antibody.HIF 1 alpha was detected in paraffin-embedded section of human intestinal cancer tissue.