HIBADH purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2291441
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human HIBADH protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human
• Immunogen: HIBADH (NP_689953.1, 1 a.a. ~ 336 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
• NCBI: NP_689953.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

HIBADH MaxPab polyclonal antibody. Western Blot analysis of HIBADH expression in HepG2.

HIBADH MaxPab polyclonal antibody. Western Blot analysis of HIBADH expression in human liver.

Immunofluorescence of purified MaxPab antibody to HIBADH on HepG2 cell. [antibody concentration 10 ug/ml]

Western Blot analysis of HIBADH expression in transfected 293T cell line by HIBADH MaxPab polyclonal antibody. Lane 1: HIBADH transfected lysate(36.96 KDa). Lane 2: Non-transfected lysate.