HERPUD1 monoclonal antibody (M04), clone 2G7

• Catalog Number: orb2291676
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HERPUD1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2G7
• Tested applications: ELISA, IHC-P, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: HERPUD1 (NP_055500, 74 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ
• NCBI: NP_055500
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged HERPUD1 is approximately 0.1 ng/ml as a capture antibody.

HERPUD1 monoclonal antibody (M04), clone 2G7 Western Blot analysis of HERPUD1 expression in HepG2.

Immunoperoxidase of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

Immunoprecipitation of HERPUD1 transfected lysate using anti-HERPUD1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HERPUD1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of HERPUD1 expression in transfected 293T cell line by HERPUD1 monoclonal antibody (M04), clone 2G7. Lane 1: HERPUD1 transfected lysate (44 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (37.51 KDa).