You have no items in your shopping cart.
Cart summary
Hepatitis delta virus genotype I (HDV) Large delta antigen Protein (His & Myc)
Catalog Number: orb1979103
| Catalog Number | orb1979103 |
|---|---|
| Category | Proteins |
| Description | Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication. Hepatitis delta virus genotype I (HDV) Large delta antigen Protein (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 27.7 kDa and the accession number is P0C6L6. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 27.7 kDa (predicted) |
| UniProt ID | P0C6L6 |
| Protein Sequence | MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFPWDILFPADPPFSPQSC |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | HDV |
| Biological Activity | Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication. Hepatitis delta virus genotype I (HDV) Large delta antigen Protein (His & Myc) is expressed in yeast with N-10xHis and C-Myc tag. The predicted molecular weight is 27.7 kDa and the accession number is P0C6L6. |
| Expression Region | 1-211 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
