Hepatitis B Virus Antibody

• Catalog Number: orb18522
• Category: Antibodies
• Description: Hepatitis B Virus Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Virus
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQ).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat Western blot, 0.1-0.5μg/ml, HBV
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 6374 MW
• UniProt ID: D2X4M3
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Large S protein ;S ;
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of Hepatitis B Virus using anti-Hepatitis B Virus antibody. Hepatitis B Virus was detected in paraffin-embedded section of human hepatitis B tissues.

IHC analysis of Hepatitis B Virus using anti-Hepatitis B Virus antibody. Hepatitis B Virus was detected in paraffin-embedded section of human liver cancer tissues.