You have no items in your shopping cart.
Cart summary
Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1978480
| Catalog Number | orb1978480 |
|---|---|
| Category | Proteins |
| Description | Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.0 kDa and the accession number is P69891. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| Protein Sequence | GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH |
| UniProt ID | P69891 |
| MW | 23.0 kDa (predicted) |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | Gamma chains make up the fetal hemoglobin F, in combination with alpha chains. Hemoglobin subunit gamma-1/HBG1 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 23.0 kDa and the accession number is P69891. |
| Expression Region | 2-147 aa |
| Storage | -20°C |
| Note | For research use only |
