HECTD3 Antibody

• Catalog Number: orb527025
• Category: Antibodies
• Description: HECTD3 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: FC, ICC, IHC, IHC-Fr, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human HECTD3 (HYASAKVCEEKLRYAAYNCVAIDTDMSPWEE).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 97 kDa
• UniProt ID: Q5T447
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: E3 ubiquitin-protein ligase HECTD3; HECT domain-co
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of A549 cells using anti-HECTD3 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of HECTD3 using anti-HECTD3 antibody.Lane 1:human Caco-2 cell;2:rat brain tissue;3:mouse brain tissue.

IHC analysis of HECTD3 using anti-HECTD3 antibody.HECTD3 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of HECTD3 using anti-HECTD3 antibody.HECTD3 was detected in paraffin-embedded section of human lung cancer tissue.

IHC analysis of HECTD3 using anti-HECTD3 antibody.HECTD3 was detected in paraffin-embedded section of mouse gaster tissue.