You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2052433 |
---|---|
Category | Proteins |
Description | HDT2 Recombinant Protein (Mouse-ear cress) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 34.3 kDa |
UniProt ID | Q56WH4 |
Protein Sequence | MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA |
Source | Yeast |
NCBI | NP_197657 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | ARABIDOPSIS HISTONE DEACETYLASE 2;AT5G22650;ATHD2; Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
34.3 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
34.3 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
37.3 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
37.3 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
37.3 kDa | |
E.coli |
Filter by Rating