You have no items in your shopping cart.
Cart summary
HDT2 Recombinant Protein (Mouse-ear cress)
Catalog Number: orb2052433
| Catalog Number | orb2052433 |
|---|---|
| Category | Proteins |
| Description | HDT2 Recombinant Protein (Mouse-ear cress) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34.3 kDa |
| UniProt ID | Q56WH4 |
| Protein Sequence | MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKKGGKSPVNANQSPKSGGQSSGGNNNKKPFNSGKQFGGSNNKGSNKGKGKGRA |
| Source | Yeast |
| NCBI | NP_197657 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | ARABIDOPSIS HISTONE DEACETYLASE 2;AT5G22650;ATHD2; Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
HDT2 Recombinant Protein (Mouse-ear cress) [orb2052432]
Greater than 90% as determined by SDS-PAGE.
34.3 kDa
Yeast
500 μgHDT2 Recombinant Protein (Mouse-ear cress) [orb2052434]
Greater than 90% as determined by SDS-PAGE.
34.3 kDa
Yeast
100 μgHDT2 Recombinant Protein (Mouse-ear cress) [orb2052498]
Greater than 90% as determined by SDS-PAGE.
37.3 kDa
E.coli
20 μgHDT2 Recombinant Protein (Mouse-ear cress) [orb2052499]
Greater than 90% as determined by SDS-PAGE.
37.3 kDa
E.coli
1 mgHDT2 Recombinant Protein (Mouse-ear cress) [orb2052500]
Greater than 90% as determined by SDS-PAGE.
37.3 kDa
E.coli
100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
