HCLS1 monoclonal antibody (M01), clone 3D5

• Catalog Number: orb2292835
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant HCLS1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D5
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
• NCBI: AAH16758
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged HCLS1 is approximately 3 ng/ml as a capture antibody.

HCLS1 monoclonal antibody (M01), clone 3D5 Western Blot analysis of HCLS1 expression in K-562.

Immunofluorescence of monoclonal antibody to HCLS1 on HeLa cell. [antibody concentration 10 ug/ml]