You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292836 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant HCK. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2A6 |
Tested applications | ELISA, PLA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | HCK (AAH14435, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIKPGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQK |
NCBI | AAH14435 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged HCK is approximately 3 ng/ml as a capture antibody.
Proximity Ligation Analysis of protein-protein interactions between FLT1 and HCK. Huh7 cells were stained with anti-FLT1 rabbit purified polyclonal 1:1200 and anti-HCK mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (34.43 KDa).