HCG antibody

• Catalog Number: orb228506
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HCG
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep, Xenopus, Zebrafish
• Reactivity: Human, Mouse, Rat
• Immunogen: A synthesized peptide derived from human CGA, corresponding to amino acid residues Q37-K87
• Dilution range: WB: 1:500-1:2000, IHC-P: 1:50-1:200
• Purity: By peptide affinity chromatography
• Conjugation: Unconjugated
• MW: 13kDa
• Protein Sequence: MDYYRKYAAIFLVTLSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
• Storage: Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Store at -20 °C. Stable for 12 months from date of receipt.
• Alternative names: anti-anterior pituitary glycoprotein hormones comm
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of JAR cell lysate using CGA antibody