GYG1 monoclonal antibody (M07), clone 3B5

• Catalog Number: orb2292851
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant GYG1.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: GYG1 (NP_004121, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLT
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 3B5
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004121
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged GYG1 is approximately 0.03 ng/ml as a capture antibody.

GYG1 monoclonal antibody (M07), clone 3B5 Western Blot analysis of GYG1 expression in HepG2.

GYG1 monoclonal antibody (M07), clone 3B5. Western Blot analysis of GYG1 expression in PC-12.

Immunoperoxidase of monoclonal antibody to GYG1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]

Western Blot analysis of GYG1 expression in transfected 293T cell line by GYG1 monoclonal antibody (M07), clone 3B5. Lane 1: GYG1 transfected lysate (37.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (33.77 KDa).